PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco006604.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family FAR1
Protein Properties Length: 537aa    MW: 60714.7 Da    PI: 10.0331
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco006604.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR190.42.4e-28200287190
         FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                  +fYn+YA++vGF vr+s+  ++++n  it+rtfvCs+eg+re++k + ++++ +r+etr+gC a+++++++++gk++vt+++++HnH la
  Aco006604.1 200 EFYNTYAENVGFFVRRSTLWTTSKNI-ITRRTFVCSREGFREKKKGA-KEAKCPRPETRIGCPACMTIRLTSNGKYRVTEFVSNHNHMLA 287
                  6********************97766.****************9999.999************************************997 PP

2FAR188.11.3e-27329416190
         FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                  +fY+ YA ++GFsvr+++++ +  ++ it+r fvCs+eg+re++k + ++ +++r+etrtgC a++ +++ +dgk++v+++++ HnH+la
  Aco006604.1 329 EFYSMYAGRIGFSVRRASMTVN-SDNAITRRMFVCSREGFREKKKGA-KRVKKPRPETRTGCPACMIIRLGQDGKYHVSEFVTYHNHQLA 416
                  6****************99998.5566****************9999.99**************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.9E-25200287IPR004330FAR1 DNA binding domain
PfamPF031016.4E-24329416IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MHVAEGVTIE TSSILRLLLL SSSAVEPNRC GGSGIGCLRG RRTRSRFHEP RRSLITWRRD  60
RETPLTSRVH YTGFRSHGRQ MPENTGSNTK EKKPRLAPAV VFPPPVQPLR PVQIPGNPSV  120
DPRLGHVWPR HLVLLSPYPP WTTQPPVPRE SIPSDSHHHH QREKMSNAPR TDANTPLEVI  180
DEKLLPKVDM LFDSENEAYE FYNTYAENVG FFVRRSTLWT TSKNIITRRT FVCSREGFRE  240
KKKGAKEAKC PRPETRIGCP ACMTIRLTSN GKYRVTEFVS NHNHMLATVS TIHMLRTKKL  300
RRKARAVRAD LVDDSVTTPV FETEDEAYEF YSMYAGRIGF SVRRASMTVN SDNAITRRMF  360
VCSREGFREK KKGAKRVKKP RPETRTGCPA CMIIRLGQDG KYHVSEFVTY HNHQLAASSS  420
AELVMSNRVE NDQDNESDLG DKSAASRAAR SFDSYAFMES QSDVLWDQVE QVLQSRHPDM  480
STLISSISDR PHNPVENVIA GSIHYDKTNH TSFIGSAADG PLTFPFTLSS GTLDYR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009398192.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009398193.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009398194.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009398195.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009398197.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009398198.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009398199.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009398200.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009398201.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLB9FXX91e-164B9FXX9_ORYSJ; Uncharacterized protein
STRINGBGIOSGA025948-PA1e-162(Oryza sativa Indica Group)
STRINGLOC_Os07g37630.11e-159(Oryza sativa Japonica Group)
STRINGORGLA07G0152100.11e-159(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-17FAR1-related sequence 5